Lineage for d1mfsa_ (1mfs A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244816Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily)
    metal(zinc)-bound fold
  4. 1244817Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) (S)
  5. 1244818Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (5 proteins)
  6. 1244822Protein HIV nucleocapsid [57760] (2 species)
    duplication: two similar zinc-binding motifs
  7. 1244823Species Human immunodeficiency virus type 1, different isolates [TaxId:11676] [57761] (12 PDB entries)
    Uniprot P03350 389-429
  8. 1244830Domain d1mfsa_: 1mfs A: [45167]
    complexed with zn

Details for d1mfsa_

PDB Entry: 1mfs (more details)

PDB Description: dynamical behavior of the hiv-1 nucleocapsid protein; nmr, 30 structures
PDB Compounds: (A:) hiv-1 nucleocapsid protein

SCOPe Domain Sequences for d1mfsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfsa_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]}
mqkgnfrnqrktvkcfncgkeghiakncraprkkgcwkcgkeghqmkdcterqan

SCOPe Domain Coordinates for d1mfsa_:

Click to download the PDB-style file with coordinates for d1mfsa_.
(The format of our PDB-style files is described here.)

Timeline for d1mfsa_: