Lineage for d1mfs__ (1mfs -)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 90465Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily)
  4. 90466Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) (S)
  5. 90467Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (5 proteins)
  6. 90471Protein HIV nucleocapsid [57760] (2 species)
  7. 90472Species Human immunodeficiency virus type 1, different isolates [TaxId:11676] [57761] (9 PDB entries)
  8. 90480Domain d1mfs__: 1mfs - [45167]

Details for d1mfs__

PDB Entry: 1mfs (more details)

PDB Description: dynamical behavior of the hiv-1 nucleocapsid protein; nmr, 30 structures

SCOP Domain Sequences for d1mfs__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfs__ g.40.1.1 (-) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates}
mqkgnfrnqrktvkcfncgkeghiakncraprkkgcwkcgkeghqmkdcterqan

SCOP Domain Coordinates for d1mfs__:

Click to download the PDB-style file with coordinates for d1mfs__.
(The format of our PDB-style files is described here.)

Timeline for d1mfs__: