Lineage for d1aaf__ (1aaf -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41478Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily)
  4. 41479Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) (S)
  5. 41480Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (5 proteins)
  6. 41484Protein HIV nucleocapsid [57760] (2 species)
  7. 41485Species Human immunodeficiency virus type 1, different isolates [TaxId:11676] [57761] (9 PDB entries)
  8. 41492Domain d1aaf__: 1aaf - [45166]

Details for d1aaf__

PDB Entry: 1aaf (more details)

PDB Description: nucleocapsid zinc fingers detected in retroviruses: exafs studies on intact viruses and the solution-state structure of the nucleocapsid protein from hiv-1

SCOP Domain Sequences for d1aaf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aaf__ g.40.1.1 (-) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates}
mqrgnfrnqrkiikcfncgkeghiakncraprkrgcwkcgkeghqmkdcterqan

SCOP Domain Coordinates for d1aaf__:

Click to download the PDB-style file with coordinates for d1aaf__.
(The format of our PDB-style files is described here.)

Timeline for d1aaf__: