![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily) metal(zinc)-bound fold |
![]() | Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) ![]() |
![]() | Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (6 proteins) |
![]() | Protein HIV nucleocapsid [57760] (2 species) duplication: two similar zinc-binding motifs |
![]() | Species Human immunodeficiency virus type 1, different isolates [TaxId:11676] [57761] (12 PDB entries) Uniprot P03350 389-429 |
![]() | Domain d1f6ua_: 1f6u A: [45164] protein/RNA complex; complexed with zn |
PDB Entry: 1f6u (more details)
SCOPe Domain Sequences for d1f6ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f6ua_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} mqkgnfrnqrktvkcfncgkeghiakncraprkkgcwkcgkeghqmkdcterqan
Timeline for d1f6ua_: