Lineage for d1f6ua_ (1f6u A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41478Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily)
  4. 41479Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) (S)
  5. 41480Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (5 proteins)
  6. 41484Protein HIV nucleocapsid [57760] (2 species)
  7. 41485Species Human immunodeficiency virus type 1, different isolates [TaxId:11676] [57761] (9 PDB entries)
  8. 41490Domain d1f6ua_: 1f6u A: [45164]

Details for d1f6ua_

PDB Entry: 1f6u (more details)

PDB Description: nmr structure of the hiv-1 nucleocapsid protein bound to stem-loop sl2 of the psi-rna packaging signal. implications for genome recognition

SCOP Domain Sequences for d1f6ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6ua_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates}
mqkgnfrnqrktvkcfncgkeghiakncraprkkgcwkcgkeghqmkdcterqan

SCOP Domain Coordinates for d1f6ua_:

Click to download the PDB-style file with coordinates for d1f6ua_.
(The format of our PDB-style files is described here.)

Timeline for d1f6ua_: