Lineage for d1hnwn_ (1hnw N:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965176Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1965177Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1965490Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 1965491Protein Ribosomal protein S14 [57753] (2 species)
  7. 1965517Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
    Uniprot P24320
  8. 1965536Domain d1hnwn_: 1hnw N: [45157]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_
    complexed with mg, tac, zn

Details for d1hnwn_

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d1hnwn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwn_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOPe Domain Coordinates for d1hnwn_:

Click to download the PDB-style file with coordinates for d1hnwn_.
(The format of our PDB-style files is described here.)

Timeline for d1hnwn_: