Lineage for d1hnzn_ (1hnz N:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750235Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 750236Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) (S)
  5. 750502Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 750503Protein Ribosomal protein S14 [57753] (1 species)
  7. 750504Species Thermus thermophilus [TaxId:274] [57754] (36 PDB entries)
  8. 750510Domain d1hnzn_: 1hnz N: [45156]
    Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_
    complexed with hyg, mg, zn

Details for d1hnzn_

PDB Entry: 1hnz (more details), 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
PDB Compounds: (N:) 30S ribosomal protein S14

SCOP Domain Sequences for d1hnzn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnzn_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOP Domain Coordinates for d1hnzn_:

Click to download the PDB-style file with coordinates for d1hnzn_.
(The format of our PDB-style files is described here.)

Timeline for d1hnzn_: