Lineage for d1xpaa2 (1xpa A:98-133)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640571Family g.39.1.5: DNA repair factor XPA DNA- and RPA-binding domain, N-terminal subdomain [57746] (1 protein)
    automatically mapped to Pfam PF01286
  6. 2640572Protein DNA repair factor XPA DNA- and RPA-binding domain, N-terminal subdomain [57747] (1 species)
  7. 2640573Species Human (Homo sapiens) [TaxId:9606] [57748] (2 PDB entries)
  8. 2640574Domain d1xpaa2: 1xpa A:98-133 [45151]
    Other proteins in same PDB: d1xpaa1
    complexed with zn

Details for d1xpaa2

PDB Entry: 1xpa (more details)

PDB Description: solution structure of the dna-and rpa-binding domain of the human repair factor xpa, nmr, 1 structure
PDB Compounds: (A:) xpa

SCOPe Domain Sequences for d1xpaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xpaa2 g.39.1.5 (A:98-133) DNA repair factor XPA DNA- and RPA-binding domain, N-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]}
mefdyviceecgkefmdsylmnhfdlptcdncrdad

SCOPe Domain Coordinates for d1xpaa2:

Click to download the PDB-style file with coordinates for d1xpaa2.
(The format of our PDB-style files is described here.)

Timeline for d1xpaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xpaa1