SCOPe 2.06: Domain d1xpaa2: 1xpa A:98-133

Lineage for d1xpaa2 (1xpa A:98-133)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.5: DNA repair factor XPA DNA- and RPA-binding domain, N-terminal subdomain [57746] (1 protein)
   automatically mapped to Pfam PF01286

6. Protein DNA repair factor XPA DNA- and RPA-binding domain, N-terminal subdomain [57747] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57748] (2 PDB entries)

8. Domain d1xpaa2: 1xpa A:98-133 [45151]
   Other proteins in same PDB: d1xpaa1
   complexed with zn

Details for d1xpaa2

PDB Entry: 1xpa

PDB Description: solution structure of the dna-and rpa-binding domain of the human repair factor xpa, nmr, 1 structure

PDB Compounds: (A:) xpa

SCOPe Domain Sequences for d1xpaa2:

Sequence; same for both SEQRES and ATOM records:

>d1xpaa2 g.39.1.5 (A:98-133) DNA repair factor XPA DNA- and RPA-binding domain, N-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]}
mefdyviceecgkefmdsylmnhfdlptcdncrdad

Timeline for d1xpaa2:

• d1xpaa2 first appeared (with stable ids) in SCOP 1.55, called d1xpa_2
  
• d1xpaa2 appears in SCOPe 2.05
  
• d1xpaa2 appears in SCOPe 2.07
  
• d1xpaa2 appears in the current release, SCOPe 2.08