Lineage for d1xpa_2 (1xpa 98-133)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41378Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 41379Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 41460Family g.39.1.5: DNA repair factor XPA DNA- and RPA-binding domain, N-terminal subdomain [57746] (1 protein)
  6. 41461Protein DNA repair factor XPA DNA- and RPA-binding domain, N-terminal subdomain [57747] (1 species)
  7. 41462Species Human (Homo sapiens) [TaxId:9606] [57748] (2 PDB entries)
  8. 41464Domain d1xpa_2: 1xpa 98-133 [45151]
    Other proteins in same PDB: d1xpa_1

Details for d1xpa_2

PDB Entry: 1xpa (more details)

PDB Description: solution structure of the dna-and rpa-binding domain of the human repair factor xpa, nmr, 1 structure

SCOP Domain Sequences for d1xpa_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xpa_2 g.39.1.5 (98-133) DNA repair factor XPA DNA- and RPA-binding domain, N-terminal subdomain {Human (Homo sapiens)}
mefdyviceecgkefmdsylmnhfdlptcdncrdad

SCOP Domain Coordinates for d1xpa_2:

Click to download the PDB-style file with coordinates for d1xpa_2.
(The format of our PDB-style files is described here.)

Timeline for d1xpa_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xpa_1