SCOP 1.75: Domain d1g47a1: 1g47 A:1-35

Lineage for d1g47a1 (1g47 A:1-35)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families)

5. Family g.39.1.3: LIM domain [57736] (18 proteins)
   duplication: contains two (sub)domains of this fold

6. Protein Pinch (particularly interesting new Cys-His) protein [57741] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57742] (5 PDB entries)

8. Domain d1g47a1: 1g47 A:1-35 [45147]
   first LIM domain

Details for d1g47a1

PDB Entry: 1g47

PDB Description: 1st lim domain of pinch protein

PDB Compounds: (A:) PINCH protein

SCOP Domain Sequences for d1g47a1:

Sequence; same for both SEQRES and ATOM records:

>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]}
manalasatcerckggfapaekivnsngelyheqc

Timeline for d1g47a1:

• d1g47a1 first appeared (with stable ids) in SCOP 1.55
  
• d1g47a1 appears in SCOP 1.73
  
• d1g47a1 appears in SCOPe 2.01
  
• d1g47a1 appears in the current release, SCOPe 2.08