Lineage for d1b8ta4 (1b8t A:144-192)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262247Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2262248Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2262386Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 2262397Protein Cysteine-rich (intestinal) protein, CRP, CRIP [57737] (4 species)
  7. 2262398Species Chicken (Gallus gallus) [TaxId:9031] [57738] (2 PDB entries)
  8. 2262402Domain d1b8ta4: 1b8t A:144-192 [45138]
    complexed with zn

Details for d1b8ta4

PDB Entry: 1b8t (more details)

PDB Description: solution structure of the chicken crp1
PDB Compounds: (A:) protein (crp1)

SCOPe Domain Sequences for d1b8ta4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]}
rcakcgkslesttladkdgeiyckgcyaknfgpkgfgfgqgagalihsq

SCOPe Domain Coordinates for d1b8ta4:

Click to download the PDB-style file with coordinates for d1b8ta4.
(The format of our PDB-style files is described here.)

Timeline for d1b8ta4: