Lineage for d1b8ta4 (1b8t A:144-192)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41378Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 41379Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 41433Family g.39.1.3: LIM domain [57736] (2 proteins)
  6. 41434Protein Cysteine-rich (intestinal) protein, CRP, CRIP [57737] (3 species)
  7. 41435Species Chicken (Gallus gallus) [TaxId:9031] [57738] (2 PDB entries)
  8. 41441Domain d1b8ta4: 1b8t A:144-192 [45138]

Details for d1b8ta4

PDB Entry: 1b8t (more details)

PDB Description: solution structure of the chicken crp1

SCOP Domain Sequences for d1b8ta4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus)}
rcakcgkslesttladkdgeiyckgcyaknfgpkgfgfgqgagalihsq

SCOP Domain Coordinates for d1b8ta4:

Click to download the PDB-style file with coordinates for d1b8ta4.
(The format of our PDB-style files is described here.)

Timeline for d1b8ta4: