Lineage for d1b8ta3 (1b8t A:101-143)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035744Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 3035755Protein Cysteine-rich (intestinal) protein, CRP, CRIP [57737] (4 species)
  7. 3035756Species Chicken (Gallus gallus) [TaxId:9031] [57738] (2 PDB entries)
  8. 3035759Domain d1b8ta3: 1b8t A:101-143 [45137]
    complexed with zn

Details for d1b8ta3

PDB Entry: 1b8t (more details)

PDB Description: solution structure of the chicken crp1
PDB Compounds: (A:) protein (crp1)

SCOPe Domain Sequences for d1b8ta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]}
tnpnasrmaqkvggsdgcprcgqavyaaekvigagkswhkscf

SCOPe Domain Coordinates for d1b8ta3:

Click to download the PDB-style file with coordinates for d1b8ta3.
(The format of our PDB-style files is described here.)

Timeline for d1b8ta3: