Lineage for d1b8ta2 (1b8t A:36-100)
- Root: SCOP 1.59
Class g: Small proteins [56992] (58 folds) 
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) 
Family g.39.1.3: LIM domain [57736] (2 proteins) Protein Cysteine-rich (intestinal) protein, CRP, CRIP [57737] (3 species) 
Species Chicken (Gallus gallus) [TaxId:9031] [57738] (2 PDB entries) 
Domain d1b8ta2: 1b8t A:36-100 [45136]
Details for d1b8ta2
PDB Entry: 1b8t (more details)
PDB Description: solution structure of the chicken crp1
SCOP Domain Sequences for d1b8ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus)}
lcmvckknldsttvavhgdeiyckscygkkygpkgkgkgmgagtlstdkgeslgikyeeg
qshrp
SCOP Domain Coordinates for d1b8ta2:
Click to download the PDB-style file with coordinates for d1b8ta2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b8ta2:
- d1b8ta2 first appeared (with stable ids) in SCOP 1.55
- d1b8ta2 appears in SCOP 1.57
- d1b8ta2 appears in SCOP 1.61
- d1b8ta2 appears in the current release, SCOPe 2.08
View in 3D
