![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.3: LIM domain [57736] (18 proteins) duplication: contains two (sub)domains of this fold |
![]() | Protein Cysteine-rich (intestinal) protein, CRP, CRIP [57737] (4 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [57738] (2 PDB entries) |
![]() | Domain d1b8ta1: 1b8t A:1-35 [45135] complexed with zn |
PDB Entry: 1b8t (more details)
SCOPe Domain Sequences for d1b8ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} mpnwgggkkcgvcqkavyfaeevqcegssfhkscf
Timeline for d1b8ta1: