Lineage for d1b8ta1 (1b8t A:1-35)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144739Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 144740Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 144800Family g.39.1.3: LIM domain [57736] (2 proteins)
  6. 144801Protein Cysteine-rich (intestinal) protein, CRP, CRIP [57737] (3 species)
  7. 144802Species Chicken (Gallus gallus) [TaxId:9031] [57738] (2 PDB entries)
  8. 144803Domain d1b8ta1: 1b8t A:1-35 [45135]

Details for d1b8ta1

PDB Entry: 1b8t (more details)

PDB Description: solution structure of the chicken crp1

SCOP Domain Sequences for d1b8ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus)}
mpnwgggkkcgvcqkavyfaeevqcegssfhkscf

SCOP Domain Coordinates for d1b8ta1:

Click to download the PDB-style file with coordinates for d1b8ta1.
(The format of our PDB-style files is described here.)

Timeline for d1b8ta1: