Lineage for d1ctla2 (1ctl A:36-85)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. Protein Cysteine-rich (intestinal) protein, CRP, CRIP [57737] (4 species)
  7. Species Chicken (Gallus gallus) [TaxId:9031] [57738] (2 PDB entries)
  8. Domain d1ctla2: 1ctl A:36-85 [45134]
    complexed with zn

Details for d1ctla2

PDB Entry: 1ctl (more details)

PDB Description: structure of the carboxy-terminal lim domain from the cysteine rich protein crp
PDB Compounds: (A:) avian cysteine rich protein

SCOPe Domain Sequences for d1ctla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ctla2 g.39.1.3 (A:36-85) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]}
frcakcgkslesttladkdgeiyckgcyaknfgpkgfgfgqgagalihsq

SCOPe Domain Coordinates for d1ctla2 are not available.

Timeline for d1ctla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ctla1