Lineage for d1ctla1 (1ctl A:1-35)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640448Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 2640459Protein Cysteine-rich (intestinal) protein, CRP, CRIP [57737] (4 species)
  7. 2640460Species Chicken (Gallus gallus) [TaxId:9031] [57738] (2 PDB entries)
  8. 2640465Domain d1ctla1: 1ctl A:1-35 [45133]
    complexed with zn

Details for d1ctla1

PDB Entry: 1ctl (more details)

PDB Description: structure of the carboxy-terminal lim domain from the cysteine rich protein crp
PDB Compounds: (A:) avian cysteine rich protein

SCOPe Domain Sequences for d1ctla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ctla1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]}
maqkvggsdgcprcgqavyaaekvigagkswhksc

SCOPe Domain Coordinates for d1ctla1:

Click to download the PDB-style file with coordinates for d1ctla1.
(The format of our PDB-style files is described here.)

Timeline for d1ctla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ctla2