Lineage for d1a6yb_ (1a6y B:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144739Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 144740Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 144754Family g.39.1.2: Nuclear receptor [57721] (7 proteins)
  6. 144774Protein Orphan nuclear receptor reverb [57734] (1 species)
  7. 144775Species Human (Homo sapiens) [TaxId:9606] [57735] (3 PDB entries)
  8. 144777Domain d1a6yb_: 1a6y B: [45132]

Details for d1a6yb_

PDB Entry: 1a6y (more details), 2.3 Å

PDB Description: reverba orphan nuclear receptor/dna complex

SCOP Domain Sequences for d1a6yb_:

Sequence, based on SEQRES records: (download)

>d1a6yb_ g.39.1.2 (B:) Orphan nuclear receptor reverb {Human (Homo sapiens)}
gmvllckvcgdvasgfhygvhacegckgffrrsiqqniqykrclknencsivrinrnrcq
qcrfkkclsvgmsrdavrfgripk

Sequence, based on observed residues (ATOM records): (download)

>d1a6yb_ g.39.1.2 (B:) Orphan nuclear receptor reverb {Human (Homo sapiens)}
gmvllckvcgdvasgfhygvlacegckgffrrsiqqniqykrclknencsivrinrnrcq
qcrfkkclsvgmsrdavrfgripk

SCOP Domain Coordinates for d1a6yb_:

Click to download the PDB-style file with coordinates for d1a6yb_.
(The format of our PDB-style files is described here.)

Timeline for d1a6yb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a6ya_