Lineage for d1a6yb_ (1a6y B:)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) 
Family g.39.1.2: Nuclear receptor [57721] (7 proteins) 
Protein Orphan nuclear receptor reverb [57734] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57735] (1 PDB entry) 
Domain d1a6yb_: 1a6y B: [45132]
Details for d1a6yb_
PDB Entry: 1a6y (more details), 2.3 Å
PDB Description: reverba orphan nuclear receptor/dna complex
SCOP Domain Sequences for d1a6yb_:
Sequence, based on SEQRES records: (download)
>d1a6yb_ g.39.1.2 (B:) Orphan nuclear receptor reverb {Human (Homo sapiens)}
gmvllckvcgdvasgfhygvhacegckgffrrsiqqniqykrclknencsivrinrnrcq
qcrfkkclsvgmsrdavrfgripk
Sequence, based on observed residues (ATOM records): (download)
>d1a6yb_ g.39.1.2 (B:) Orphan nuclear receptor reverb {Human (Homo sapiens)}
gmvllckvcgdvasgfhygvlacegckgffrrsiqqniqykrclknencsivrinrnrcq
qcrfkkclsvgmsrdavrfgripk
SCOP Domain Coordinates for d1a6yb_:
Click to download the PDB-style file with coordinates for d1a6yb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a6yb_:
- d1a6yb_ appears in SCOP 1.57
- d1a6yb_ appears in the current release, SCOPe 2.08
View in 3D
