Class g: Small proteins [56992] (100 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.2: Nuclear receptor [57721] (13 proteins) duplication: two zinc-binding motifs |
Protein Orphan nuclear receptor reverb DNA-binding domain [57734] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57735] (3 PDB entries) |
Domain d1a6yb_: 1a6y B: [45132] protein/DNA complex; complexed with zn |
PDB Entry: 1a6y (more details), 2.3 Å
SCOPe Domain Sequences for d1a6yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6yb_ g.39.1.2 (B:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} gmvllckvcgdvasgfhygvlacegckgffrrsiqqniqykrclknencsivrinrnrcq qcrfkkclsvgmsrdavrfgripk
Timeline for d1a6yb_: