SCOPe 2.08: Domain d1a6yb_: 1a6y B:

Lineage for d1a6yb_ (1a6y B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
   duplication: two zinc-binding motifs

6. Protein Orphan nuclear receptor reverb DNA-binding domain [57734] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57735] (3 PDB entries)

8. Domain d1a6yb_: 1a6y B: [45132]
   protein/DNA complex; complexed with zn

Details for d1a6yb_

PDB Entry: 1a6y, 2.3 Å

PDB Description: reverba orphan nuclear receptor/dna complex

PDB Compounds: (B:) orphan nuclear receptor nr1d1

SCOPe Domain Sequences for d1a6yb_:

Sequence; same for both SEQRES and ATOM records:

>d1a6yb_ g.39.1.2 (B:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
gmvllckvcgdvasgfhygvlacegckgffrrsiqqniqykrclknencsivrinrnrcq
qcrfkkclsvgmsrdavrfgripk

Timeline for d1a6yb_:

• d1a6yb_ first appeared (with stable ids) in SCOP 1.55
  
• d1a6yb_ appears in SCOPe 2.07