Lineage for d1hra__ (1hra -)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 90358Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 90359Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 90373Family g.39.1.2: Nuclear receptor [57721] (7 proteins)
  6. 90397Protein Retinoic acid receptor DNA-binding domain [57732] (1 species)
  7. 90398Species Human (Homo sapiens) [TaxId:9606] [57733] (2 PDB entries)
  8. 90400Domain d1hra__: 1hra - [45130]

Details for d1hra__

PDB Entry: 1hra (more details)

PDB Description: the solution structure of the human retinoic acid receptor-beta dna- binding domain

SCOP Domain Sequences for d1hra__:

Sequence, based on SEQRES records: (download)

>d1hra__ g.39.1.2 (-) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens)}
pprvykpcfvcqdkssgyhygvsacegckgffrrsiqknmiytchrdkncvinkvtrnrc
qycrlqkcfevgmskesvrn

Sequence, based on observed residues (ATOM records): (download)

>d1hra__ g.39.1.2 (-) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens)}
mprvykpcfvcqdkssgyhygvsacegckgffrrsiqknmiytchrdkncvinkvtrnrc
qycrlqkcfevgmskesvrn

SCOP Domain Coordinates for d1hra__:

Click to download the PDB-style file with coordinates for d1hra__.
(The format of our PDB-style files is described here.)

Timeline for d1hra__: