SCOPe 2.07: Domain d1hraa_: 1hra A:

Lineage for d1hraa_ (1hra A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
   duplication: two zinc-binding motifs

6. Protein Retinoic acid receptor DNA-binding domain [57732] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57733] (2 PDB entries)

8. Domain d1hraa_: 1hra A: [45130]
   complexed with zn

Details for d1hraa_

PDB Entry: 1hra

PDB Description: the solution structure of the human retinoic acid receptor-beta dna-binding domain

PDB Compounds: (A:) retinoic acid receptor

SCOPe Domain Sequences for d1hraa_:

Sequence; same for both SEQRES and ATOM records:

>d1hraa_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
mprvykpcfvcqdkssgyhygvsacegckgffrrsiqknmiytchrdkncvinkvtrnrc
qycrlqkcfevgmskesvrn

Timeline for d1hraa_:

• d1hraa_ first appeared (with stable ids) in SCOP 1.55, called d1hra__
  
• d1hraa_ appears in SCOPe 2.06