SCOPe 2.07: Domain d1dsza_: 1dsz A:

Lineage for d1dsza_ (1dsz A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
   duplication: two zinc-binding motifs

6. Protein Retinoic acid receptor DNA-binding domain [57732] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57733] (2 PDB entries)

8. Domain d1dsza_: 1dsz A: [45129]
   Other proteins in same PDB: d1dszb_
   protein/DNA complex; complexed with zn

Details for d1dsza_

PDB Entry: 1dsz, 1.7 Å

PDB Description: structure of the rxr/rar dna-binding domain heterodimer in complex with the retinoic acid response element dr1

PDB Compounds: (A:) retinoic acid receptor alpha

SCOPe Domain Sequences for d1dsza_:

Sequence; same for both SEQRES and ATOM records:

>d1dsza_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
pcfvcqdkssgyhygvsacegckgffrrsiqknmvytchrdknciinkvtrnrcqycrlq
kcfevgmskesvrnd

Timeline for d1dsza_:

• d1dsza_ first appeared (with stable ids) in SCOP 1.55
  
• d1dsza_ appears in SCOPe 2.06
  
• d1dsza_ appears in the current release, SCOPe 2.08