Lineage for d1rgd__ (1rgd -)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 344032Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 344033Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (9 families) (S)
  5. 344047Family g.39.1.2: Nuclear receptor [57721] (9 proteins)
    duplication: two zinc-binding motifs
  6. 344055Protein Glucocorticoid receptor DNA-binding domain [57730] (1 species)
  7. 344056Species Rat (Rattus norvegicus) [TaxId:10116] [57731] (5 PDB entries)
  8. 344063Domain d1rgd__: 1rgd - [45128]
    complexed with zn

Details for d1rgd__

PDB Entry: 1rgd (more details)

PDB Description: structure refinement of the glucocorticoid receptor-dna binding domain from nmr data by relaxation matrix calculations

SCOP Domain Sequences for d1rgd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rgd__ g.39.1.2 (-) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus)}
clvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacryrk
clqagmnlear

SCOP Domain Coordinates for d1rgd__:

Click to download the PDB-style file with coordinates for d1rgd__.
(The format of our PDB-style files is described here.)

Timeline for d1rgd__: