Lineage for d1rgd__ (1rgd -)
- Root: SCOP 1.57
Class g: Small proteins [56992] (56 folds) 
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) 
Family g.39.1.2: Nuclear receptor [57721] (7 proteins) 
Protein Glucocorticoid receptor DNA-binding domain [57730] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [57731] (5 PDB entries) 
Domain d1rgd__: 1rgd - [45128]
Details for d1rgd__
PDB Entry: 1rgd (more details)
PDB Description: structure refinement of the glucocorticoid receptor-dna binding domain from nmr data by relaxation matrix calculations
SCOP Domain Sequences for d1rgd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rgd__ g.39.1.2 (-) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus)}
clvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacryrk
clqagmnlear
SCOP Domain Coordinates for d1rgd__:
Click to download the PDB-style file with coordinates for d1rgd__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rgd__:
- d1rgd__ first appeared (with stable ids) in SCOP 1.55
- d1rgd__ appears in SCOP 1.59
- d1rgd__ appears in the current release, SCOPe 2.08, called d1rgda_
View in 3D