SCOPe 2.06: Domain d1gdca_: 1gdc A:

Lineage for d1gdca_ (1gdc A:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
   duplication: two zinc-binding motifs

6. Protein Glucocorticoid receptor DNA-binding domain [57730] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [57731] (11 PDB entries)

8. Domain d1gdca_: 1gdc A: [45127]
   complexed with zn

Details for d1gdca_

PDB Entry: 1gdc

PDB Description: refined solution structure of the glucocorticoid receptor dna-binding domain

PDB Compounds: (A:) Glucocorticoid receptor

SCOPe Domain Sequences for d1gdca_:

Sequence; same for both SEQRES and ATOM records:

>d1gdca_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacryr
kclqagmnlear

Timeline for d1gdca_:

• d1gdca_ first appeared (with stable ids) in SCOP 1.55, called d1gdc__
  
• d1gdca_ appears in SCOPe 2.05
  
• d1gdca_ appears in SCOPe 2.07
  
• d1gdca_ appears in the current release, SCOPe 2.08