Lineage for d1gdc__ (1gdc -)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 429921Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 429922Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (11 families) (S)
  5. 429936Family g.39.1.2: Nuclear receptor [57721] (11 proteins)
    duplication: two zinc-binding motifs
  6. 429948Protein Glucocorticoid receptor DNA-binding domain [57730] (1 species)
  7. 429949Species Rat (Rattus norvegicus) [TaxId:10116] [57731] (7 PDB entries)
  8. 429958Domain d1gdc__: 1gdc - [45127]
    complexed with zn

Details for d1gdc__

PDB Entry: 1gdc (more details)

PDB Description: refined solution structure of the glucocorticoid receptor dna-binding domain

SCOP Domain Sequences for d1gdc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gdc__ g.39.1.2 (-) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus)}
lclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacryr
kclqagmnlear

SCOP Domain Coordinates for d1gdc__:

Click to download the PDB-style file with coordinates for d1gdc__.
(The format of our PDB-style files is described here.)

Timeline for d1gdc__: