Lineage for d1gdc__ (1gdc -)
- Root: SCOP 1.57
Class g: Small proteins [56992] (56 folds) 
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) 
Family g.39.1.2: Nuclear receptor [57721] (7 proteins) 
Protein Glucocorticoid receptor DNA-binding domain [57730] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [57731] (5 PDB entries) 
Domain d1gdc__: 1gdc - [45127]
Details for d1gdc__
PDB Entry: 1gdc (more details)
PDB Description: refined solution structure of the glucocorticoid receptor dna-binding domain
SCOP Domain Sequences for d1gdc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gdc__ g.39.1.2 (-) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus)}
lclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacryr
kclqagmnlear
SCOP Domain Coordinates for d1gdc__:
Click to download the PDB-style file with coordinates for d1gdc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gdc__:
- d1gdc__ first appeared (with stable ids) in SCOP 1.55
- d1gdc__ appears in SCOP 1.59
- d1gdc__ appears in the current release, SCOPe 2.08, called d1gdca_
View in 3D