Lineage for d2gda__ (2gda -)
- Root: SCOP 1.59
Class g: Small proteins [56992] (58 folds) 
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) 
Family g.39.1.2: Nuclear receptor [57721] (7 proteins) 
Protein Glucocorticoid receptor DNA-binding domain [57730] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [57731] (5 PDB entries) 
Domain d2gda__: 2gda - [45126]
Details for d2gda__
PDB Entry: 2gda (more details)
PDB Description: refined solution structure of the glucocorticoid receptor dna-binding domain
SCOP Domain Sequences for d2gda__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gda__ g.39.1.2 (-) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus)}
lclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacryr
kclqagmnlear
SCOP Domain Coordinates for d2gda__:
Click to download the PDB-style file with coordinates for d2gda__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2gda__:
- d2gda__ first appeared (with stable ids) in SCOP 1.55
- d2gda__ appears in SCOP 1.57
- d2gda__ appears in SCOP 1.61
- d2gda__ appears in the current release, SCOPe 2.08, called d2gdaa_
View in 3D