SCOP 1.63: Domain d1glub_: 1glu B:

Lineage for d1glub_ (1glu B:)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (9 families)

5. Family g.39.1.2: Nuclear receptor [57721] (8 proteins)
   duplication: two zinc-binding motifs

6. Protein Glucocorticoid receptor DNA-binding domain [57730] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [57731] (5 PDB entries)

8. Domain d1glub_: 1glu B: [45125]
   protein/DNA complex; complexed with zn

Details for d1glub_

PDB Entry: 1glu, 2.9 Å

PDB Description: crystallographic analysis of the interaction of the glucocorticoid receptor with dna

SCOP Domain Sequences for d1glub_:

Sequence; same for both SEQRES and ATOM records:

>d1glub_ g.39.1.2 (B:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus)}
mkparpclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncp
acryrkclqagmnlearktkk

Timeline for d1glub_:

• d1glub_ first appeared (with stable ids) in SCOP 1.55
  
• d1glub_ appears in SCOP 1.61
  
• d1glub_ appears in SCOP 1.65
  
• d1glub_ appears in the current release, SCOPe 2.08, called d1glub1