Lineage for d1glub_ (1glu B:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144739Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 144740Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 144754Family g.39.1.2: Nuclear receptor [57721] (7 proteins)
  6. 144762Protein Glucocorticoid receptor DNA-binding domain [57730] (1 species)
  7. 144763Species Rat (Rattus norvegicus) [TaxId:10116] [57731] (5 PDB entries)
  8. 144767Domain d1glub_: 1glu B: [45125]

Details for d1glub_

PDB Entry: 1glu (more details), 2.9 Å

PDB Description: crystallographic analysis of the interaction of the glucocorticoid receptor with dna

SCOP Domain Sequences for d1glub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glub_ g.39.1.2 (B:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus)}
mkparpclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncp
acryrkclqagmnlearktkk

SCOP Domain Coordinates for d1glub_:

Click to download the PDB-style file with coordinates for d1glub_.
(The format of our PDB-style files is described here.)

Timeline for d1glub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1glua_