![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.2: Nuclear receptor [57721] (13 proteins) duplication: two zinc-binding motifs |
![]() | Protein Glucocorticoid receptor DNA-binding domain [57730] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [57731] (11 PDB entries) |
![]() | Domain d1glub1: 1glu B:436-514 [45125] Other proteins in same PDB: d1glua2, d1glub2 protein/DNA complex; complexed with zn |
PDB Entry: 1glu (more details), 2.9 Å
SCOPe Domain Sequences for d1glub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1glub1 g.39.1.2 (B:436-514) Glucocorticoid receptor DNA-binding domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} parpclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpac ryrkclqagmnlearktkk
Timeline for d1glub1: