Lineage for d1glub1 (1glu B:436-514)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035613Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. 3035629Protein Glucocorticoid receptor DNA-binding domain [57730] (2 species)
  7. 3035639Species Norway rat (Rattus norvegicus) [TaxId:10116] [57731] (11 PDB entries)
  8. 3035653Domain d1glub1: 1glu B:436-514 [45125]
    Other proteins in same PDB: d1glua2, d1glub2
    protein/DNA complex; complexed with zn

Details for d1glub1

PDB Entry: 1glu (more details), 2.9 Å

PDB Description: crystallographic analysis of the interaction of the glucocorticoid receptor with dna
PDB Compounds: (B:) protein (glucocorticoid receptor)

SCOPe Domain Sequences for d1glub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glub1 g.39.1.2 (B:436-514) Glucocorticoid receptor DNA-binding domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
parpclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpac
ryrkclqagmnlearktkk

SCOPe Domain Coordinates for d1glub1:

Click to download the PDB-style file with coordinates for d1glub1.
(The format of our PDB-style files is described here.)

Timeline for d1glub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1glub2