Lineage for d1glua_ (1glu A:)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) 
Family g.39.1.2: Nuclear receptor [57721] (7 proteins) 
Protein Glucocorticoid receptor DNA-binding domain [57730] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [57731] (5 PDB entries) 
Domain d1glua_: 1glu A: [45124]
Details for d1glua_
PDB Entry: 1glu (more details), 2.9 Å
PDB Description: crystallographic analysis of the interaction of the glucocorticoid receptor with dna
SCOP Domain Sequences for d1glua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1glua_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus)}
mkparpclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncp
acryrkclqagmnlearktkk
SCOP Domain Coordinates for d1glua_:
Click to download the PDB-style file with coordinates for d1glua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1glua_:
- d1glua_ appears in SCOP 1.57
- d1glua_ appears in the current release, SCOPe 2.08, called d1glua1
View in 3D
