SCOPe 2.06: Domain d1latb1: 1lat B:440-510

Lineage for d1latb1 (1lat B:440-510)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
   duplication: two zinc-binding motifs

6. Protein Glucocorticoid receptor DNA-binding domain [57730] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [57731] (11 PDB entries)

8. Domain d1latb1: 1lat B:440-510 [45123]
   Other proteins in same PDB: d1lata2, d1latb2
   protein/DNA complex; complexed with zn; mutant

Details for d1latb1

PDB Entry: 1lat, 1.9 Å

PDB Description: glucocorticoid receptor mutant/dna complex

PDB Compounds: (B:) Glucocorticoid receptor

SCOPe Domain Sequences for d1latb1:

Sequence; same for both SEQRES and ATOM records:

>d1latb1 g.39.1.2 (B:440-510) Glucocorticoid receptor DNA-binding domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
clvcsdeasgchygvltcegckaffkravegqhnylckyegkciidkirrkncpacryrk
clqagmnlear

Timeline for d1latb1:

• d1latb1 first appeared (with stable ids) in SCOP 1.55, called d1latb_
  
• d1latb1 was called d1latb_ in SCOPe 2.05
  
• d1latb1 appears in SCOPe 2.07
  
• d1latb1 appears in the current release, SCOPe 2.08