SCOP 1.67: Domain d1latb_: 1lat B:

Lineage for d1latb_ (1lat B:)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (11 families)

5. Family g.39.1.2: Nuclear receptor [57721] (11 proteins)
   duplication: two zinc-binding motifs

6. Protein Glucocorticoid receptor DNA-binding domain [57730] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [57731] (7 PDB entries)

8. Domain d1latb_: 1lat B: [45123]
   protein/DNA complex; complexed with zn; mutant

Details for d1latb_

PDB Entry: 1lat, 1.9 Å

PDB Description: glucocorticoid receptor mutant/dna complex

SCOP Domain Sequences for d1latb_:

Sequence; same for both SEQRES and ATOM records:

>d1latb_ g.39.1.2 (B:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus)}
arpclvcsdeasgchygvltcegckaffkravegqhnylckyegkciidkirrkncpacr
yrkclqagmnlear

Timeline for d1latb_:

• d1latb_ first appeared (with stable ids) in SCOP 1.55
  
• d1latb_ appears in SCOP 1.65
  
• d1latb_ appears in SCOP 1.69
  
• d1latb_ appears in the current release, SCOPe 2.08, called d1latb1