SCOPe 2.04: Domain d1hcqe_: 1hcq E:

Lineage for d1hcqe_ (1hcq E:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
   duplication: two zinc-binding motifs

6. Protein Estrogen receptor DNA-binding domain [57728] (1 species)

7. Species Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId:9606] [57729] (2 PDB entries)
   identical sequences

8. Domain d1hcqe_: 1hcq E: [45119]
   protein/DNA complex; complexed with zn

Details for d1hcqe_

PDB Entry: 1hcq, 2.4 Å

PDB Description: the crystal structure of the estrogen receptor dna-binding domain bound to dna: how receptors discriminate between their response elements

PDB Compounds: (E:) protein (estrogen receptor)

SCOPe Domain Sequences for d1hcqe_:

Sequence; same for both SEQRES and ATOM records:

>d1hcqe_ g.39.1.2 (E:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]}
mketrycavcndyasgyhygvwscegckaffkrsiqghndymcpatnqctidknrrkscq
acrlrkcyevgmmk

Timeline for d1hcqe_:

• d1hcqe_ first appeared (with stable ids) in SCOP 1.55
  
• d1hcqe_ appears in SCOPe 2.03
  
• d1hcqe_ appears in SCOPe 2.05
  
• d1hcqe_ appears in the current release, SCOPe 2.08