| Class g: Small proteins [56992] (91 folds) |
| Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
| Family g.39.1.2: Nuclear receptor [57721] (13 proteins) duplication: two zinc-binding motifs |
| Protein Estrogen receptor DNA-binding domain [57728] (1 species) |
| Species Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId:9606] [57729] (2 PDB entries) identical sequences |
| Domain d1hcqe_: 1hcq E: [45119] protein/DNA complex; complexed with zn |
PDB Entry: 1hcq (more details), 2.4 Å
SCOPe Domain Sequences for d1hcqe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hcqe_ g.39.1.2 (E:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]}
mketrycavcndyasgyhygvwscegckaffkrsiqghndymcpatnqctidknrrkscq
acrlrkcyevgmmk
Timeline for d1hcqe_: