Lineage for d1cita_ (1cit A:)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) 
Family g.39.1.2: Nuclear receptor [57721] (7 proteins) 
Protein Orphan nuclear receptor NGFI-B [57726] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [57727] (1 PDB entry) 
Domain d1cita_: 1cit A: [45116]
Details for d1cita_
PDB Entry: 1cit (more details), 2.7 Å
PDB Description: dna-binding mechanism of the monomeric orphan nuclear receptor ngfi-b
SCOP Domain Sequences for d1cita_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B {Rat (Rattus norvegicus)}
grcavcgdnascqhygvrtcegckgffkrtvqksakyiclankdcpvdkrrrnrcqfcrf
qkclavgmvkevvrtdslkgrrgrlpskp
SCOP Domain Coordinates for d1cita_:
Click to download the PDB-style file with coordinates for d1cita_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cita_:
- d1cita_ appears in SCOP 1.57
- d1cita_ appears in the current release, SCOPe 2.08
View in 3D