Lineage for d1cita_ (1cit A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586757Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2586758Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2586782Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. 2586819Protein Orphan nuclear receptor NGFI-B DNA-binding domain [57726] (1 species)
  7. 2586820Species Norway rat (Rattus norvegicus) [TaxId:10116] [57727] (1 PDB entry)
  8. 2586821Domain d1cita_: 1cit A: [45116]
    protein/DNA complex; complexed with zn

Details for d1cita_

PDB Entry: 1cit (more details), 2.7 Å

PDB Description: dna-binding mechanism of the monomeric orphan nuclear receptor ngfi-b
PDB Compounds: (A:) protein (orphan nuclear receptor ngfi-b)

SCOPe Domain Sequences for d1cita_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-binding domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
grcavcgdnascqhygvrtcegckgffkrtvqksakyiclankdcpvdkrrrnrcqfcrf
qkclavgmvkevvrtdslkgrrgrlpskp

SCOPe Domain Coordinates for d1cita_:

Click to download the PDB-style file with coordinates for d1cita_.
(The format of our PDB-style files is described here.)

Timeline for d1cita_: