SCOP 1.67: Domain d2nllb_: 2nll B:

Lineage for d2nllb_ (2nll B:)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (11 families)

5. Family g.39.1.2: Nuclear receptor [57721] (11 proteins)
   duplication: two zinc-binding motifs

6. Protein Thyroid hormone receptor (TR-beta) DNA-binding domain [57724] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57725] (1 PDB entry)

8. Domain d2nllb_: 2nll B: [45115]
   Other proteins in same PDB: d2nlla_
   protein/DNA complex; complexed with 5iu, zn

Details for d2nllb_

PDB Entry: 2nll, 1.9 Å

PDB Description: retinoid x receptor-thyroid hormone receptor dna-binding domain heterodimer bound to thyroid response element dna

SCOP Domain Sequences for d2nllb_:

Sequence; same for both SEQRES and ATOM records:

>d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens)}
delcvvcgdkatgyhyrcitcegckgffrrtiqknlhpsysckyegkcvidkvtrnqcqe
crfkkciyvgmatdlvlddskrlakrklieenrekrrreelek

Timeline for d2nllb_:

• d2nllb_ first appeared (with stable ids) in SCOP 1.55
  
• d2nllb_ appears in SCOP 1.65
  
• d2nllb_ appears in SCOP 1.69
  
• d2nllb_ appears in the current release, SCOPe 2.08