Lineage for d2nllb_ (2nll B:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 204719Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 204720Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 204734Family g.39.1.2: Nuclear receptor [57721] (8 proteins)
  6. 204777Protein Thyroid hormone receptor (TR-beta) DNA-binding domain [57724] (1 species)
  7. 204778Species Human (Homo sapiens) [TaxId:9606] [57725] (1 PDB entry)
  8. 204779Domain d2nllb_: 2nll B: [45115]
    Other proteins in same PDB: d2nlla_

Details for d2nllb_

PDB Entry: 2nll (more details), 1.9 Å

PDB Description: retinoid x receptor-thyroid hormone receptor dna-binding domain heterodimer bound to thyroid response element dna

SCOP Domain Sequences for d2nllb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens)}
delcvvcgdkatgyhyrcitcegckgffrrtiqknlhpsysckyegkcvidkvtrnqcqe
crfkkciyvgmatdlvlddskrlakrklieenrekrrreelek

SCOP Domain Coordinates for d2nllb_:

Click to download the PDB-style file with coordinates for d2nllb_.
(The format of our PDB-style files is described here.)

Timeline for d2nllb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2nlla_