Lineage for d1rxr__ (1rxr -)
- Root: SCOP 1.59
Class g: Small proteins [56992] (58 folds) 
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) 
Family g.39.1.2: Nuclear receptor [57721] (7 proteins) 
Protein Retinoid X receptor (RXR-alpha) DNA-binding domain [57722] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57723] (4 PDB entries) 
Domain d1rxr__: 1rxr - [45114]
Details for d1rxr__
PDB Entry: 1rxr (more details)
PDB Description: high resolution solution structure of the retinoid x receptor dna binding domain, nmr, 20 structure
SCOP Domain Sequences for d1rxr__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rxr__ g.39.1.2 (-) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens)}
ftkhicaicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqy
cryqkalamgmkreavqeerqrg
SCOP Domain Coordinates for d1rxr__:
Click to download the PDB-style file with coordinates for d1rxr__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rxr__:
- d1rxr__ first appeared (with stable ids) in SCOP 1.55
- d1rxr__ appears in SCOP 1.57
- d1rxr__ appears in SCOP 1.61
- d1rxr__ appears in the current release, SCOPe 2.08, called d1rxra_
View in 3D