Lineage for d1by4d_ (1by4 D:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640318Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. 2640372Protein Retinoid X receptor (RXR-alpha) DNA-binding domain [57722] (1 species)
  7. 2640373Species Human (Homo sapiens) [TaxId:9606] [57723] (5 PDB entries)
  8. 2640379Domain d1by4d_: 1by4 D: [45113]
    protein/DNA complex; complexed with zn

Details for d1by4d_

PDB Entry: 1by4 (more details), 2.1 Å

PDB Description: structure and mechanism of the homodimeric assembly of the rxr on dna
PDB Compounds: (D:) protein (retinoic acid receptor rxr-alpha)

SCOPe Domain Sequences for d1by4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1by4d_ g.39.1.2 (D:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
sftkhicaicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcq
ycryqkclamgmkreavqee

SCOPe Domain Coordinates for d1by4d_:

Click to download the PDB-style file with coordinates for d1by4d_.
(The format of our PDB-style files is described here.)

Timeline for d1by4d_: