Lineage for d1by4d_ (1by4 D:)
- Root: SCOP 1.59
Class g: Small proteins [56992] (58 folds) 
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) 
Family g.39.1.2: Nuclear receptor [57721] (7 proteins) 
Protein Retinoid X receptor (RXR-alpha) DNA-binding domain [57722] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57723] (4 PDB entries) 
Domain d1by4d_: 1by4 D: [45113]
Details for d1by4d_
PDB Entry: 1by4 (more details), 2.1 Å
PDB Description: structure and mechanism of the homodimeric assembly of the rxr on dna
SCOP Domain Sequences for d1by4d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1by4d_ g.39.1.2 (D:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens)}
sftkhicaicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcq
ycryqkclamgmkreavqee
SCOP Domain Coordinates for d1by4d_:
Click to download the PDB-style file with coordinates for d1by4d_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1by4d_:
- d1by4d_ first appeared (with stable ids) in SCOP 1.55
- d1by4d_ appears in SCOP 1.57
- d1by4d_ appears in SCOP 1.61
- d1by4d_ appears in the current release, SCOPe 2.08
View in 3D
