Lineage for d1by4c_ (1by4 C:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144739Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 144740Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 144754Family g.39.1.2: Nuclear receptor [57721] (7 proteins)
  6. 144788Protein Retinoid X receptor (RXR-alpha) DNA-binding domain [57722] (1 species)
  7. 144789Species Human (Homo sapiens) [TaxId:9606] [57723] (4 PDB entries)
  8. 144794Domain d1by4c_: 1by4 C: [45112]

Details for d1by4c_

PDB Entry: 1by4 (more details), 2.1 Å

PDB Description: structure and mechanism of the homodimeric assembly of the rxr on dna

SCOP Domain Sequences for d1by4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1by4c_ g.39.1.2 (C:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens)}
khicaicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqycr
yqkclamgmkreavqeer

SCOP Domain Coordinates for d1by4c_:

Click to download the PDB-style file with coordinates for d1by4c_.
(The format of our PDB-style files is described here.)

Timeline for d1by4c_: