Lineage for d1by4a_ (1by4 A:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 204719Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 204720Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 204734Family g.39.1.2: Nuclear receptor [57721] (8 proteins)
  6. 204768Protein Retinoid X receptor (RXR-alpha) DNA-binding domain [57722] (1 species)
  7. 204769Species Human (Homo sapiens) [TaxId:9606] [57723] (4 PDB entries)
  8. 204772Domain d1by4a_: 1by4 A: [45110]

Details for d1by4a_

PDB Entry: 1by4 (more details), 2.1 Å

PDB Description: structure and mechanism of the homodimeric assembly of the rxr on dna

SCOP Domain Sequences for d1by4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1by4a_ g.39.1.2 (A:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens)}
tkhicaicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqyc
ryqkclamgmkreavqeer

SCOP Domain Coordinates for d1by4a_:

Click to download the PDB-style file with coordinates for d1by4a_.
(The format of our PDB-style files is described here.)

Timeline for d1by4a_: