SCOP 1.63: Domain d2nlla_: 2nll A:

Lineage for d2nlla_ (2nll A:)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (9 families)

5. Family g.39.1.2: Nuclear receptor [57721] (8 proteins)
   duplication: two zinc-binding motifs

6. Protein Retinoid X receptor (RXR-alpha) DNA-binding domain [57722] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57723] (4 PDB entries)

8. Domain d2nlla_: 2nll A: [45109]
   Other proteins in same PDB: d2nllb_
   protein/DNA complex; complexed with 5iu, zn

Details for d2nlla_

PDB Entry: 2nll, 1.9 Å

PDB Description: retinoid x receptor-thyroid hormone receptor dna-binding domain heterodimer bound to thyroid response element dna

SCOP Domain Sequences for d2nlla_:

Sequence; same for both SEQRES and ATOM records:

>d2nlla_ g.39.1.2 (A:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens)}
caicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqycryqk
clamgm

Timeline for d2nlla_:

• d2nlla_ first appeared (with stable ids) in SCOP 1.55
  
• d2nlla_ appears in SCOP 1.61
  
• d2nlla_ appears in SCOP 1.65
  
• d2nlla_ appears in the current release, SCOPe 2.08