SCOPe 2.07: Domain d1dszb_: 1dsz B:

Lineage for d1dszb_ (1dsz B:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
   duplication: two zinc-binding motifs

6. Protein Retinoid X receptor (RXR-alpha) DNA-binding domain [57722] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57723] (5 PDB entries)

8. Domain d1dszb_: 1dsz B: [45108]
   Other proteins in same PDB: d1dsza_
   protein/DNA complex; complexed with zn

Details for d1dszb_

PDB Entry: 1dsz, 1.7 Å

PDB Description: structure of the rxr/rar dna-binding domain heterodimer in complex with the retinoic acid response element dr1

PDB Compounds: (B:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d1dszb_:

Sequence; same for both SEQRES and ATOM records:

>d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
gsftkhicaicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrc
qycryqkclamgmkreavqeerqr

Timeline for d1dszb_:

• d1dszb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dszb_ appears in SCOPe 2.06
  
• d1dszb_ appears in the current release, SCOPe 2.08