Lineage for d1dszb_ (1dsz B:)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) 
Family g.39.1.2: Nuclear receptor [57721] (7 proteins) 
Protein Retinoid X receptor (RXR-alpha) DNA-binding domain [57722] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57723] (4 PDB entries) 
Domain d1dszb_: 1dsz B: [45108]
Other proteins in same PDB: d1dsza_
Details for d1dszb_
PDB Entry: 1dsz (more details), 1.7 Å
PDB Description: structure of the rxr/rar dna-binding domain heterodimer in complex with the retinoic acid response element dr1
SCOP Domain Sequences for d1dszb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens)}
gsftkhicaicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrc
qycryqkclamgmkreavqeerqr
SCOP Domain Coordinates for d1dszb_:
Click to download the PDB-style file with coordinates for d1dszb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dszb_:
- d1dszb_ appears in SCOP 1.57
- d1dszb_ appears in the current release, SCOPe 2.08
View in 3D
